EFHD2 anticorps (N-Term)

N° du produit ABIN631302

Cet anticorps anti-EFHD2 est un anticorps Lapin Polyclonal détectant EFHD2 dans WB. Adapté pour Humain.

Aperçu rapide pour EFHD2 anticorps (N-Term) (ABIN631302)

Antigène: EFHD2 (EF-Hand Domain Family, Member D2 (EFHD2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EFHD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EFHD2 anticorps

Épitope: N-Term

Specificité: EFHD2 antibody was raised against the N terminal of EFHD2

Purification: Affinity purified

Immunogène: EFHD2 antibody was raised using the N terminal of EFHD2 corresponding to a region with amino acids MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFHD2 Blocking Peptide, (ABIN5613315), is also available for use as a blocking control in assays to test for specificity of this EFHD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EFHD2

Antigène: EFHD2 (EF-Hand Domain Family, Member D2 (EFHD2))

Autre désignation: EFHD2

Sujet: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.

Poids moléculaire: 26 kDa (MW of target protein)